Protein Info for IAI46_18220 in Serratia liquefaciens MT49

Annotation: ion channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 90 to 116 (27 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 323 to 340 (18 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 370 to 400 (31 residues), see Phobius details PF00654: Voltage_CLC" amino acids 68 to 397 (330 residues), 79.4 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 70% identical to YFEO_ECO55: Putative ion-transport protein YfeO (yfeO) from Escherichia coli (strain 55989 / EAEC)

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_3601)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>IAI46_18220 ion channel protein (Serratia liquefaciens MT49)
MLHPRANAMLAFALPALIIGSASSLVLILVMKFAEALQRLLWVNVPAALNIDTHSPWWLV
GMLTLTGVAVGLIIRFLPGHAGPDPATESLIGMPLPLSAVPGLGLALIIGLAGGVSLGPE
NPITAINIALVVAAGSRLLPKVPRMDWIILAAAGTIGALFGTPVAAALIFSQTLAGNNDV
PLWDRLFAPLMAAAAGAVTTQLFFTPNFSLQIDAYAATRLADIFSGSIVALIAIALGMVA
VWSFPHIHRLFHSIKNPVLMLGLGGFVLGLLALIGGEITLFKGLDEMKQLAIGENFSVTE
LMLITLTKLAALVIAAASGFRGGRIFPAVFVGVALGLMLHQHVPAVPAAITVSCAIMGLV
LVVTRDGWLSLFMAVAVVPELHLLPVLCIVMLPAWLVLAGKPLMLVGKGKQLPPRED