Protein Info for IAI46_18140 in Serratia liquefaciens MT49

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details PF00892: EamA" amino acids 15 to 143 (129 residues), 65.5 bits, see alignment E=2.9e-22 amino acids 157 to 292 (136 residues), 66.8 bits, see alignment E=1.1e-22

Best Hits

KEGG orthology group: None (inferred from 86% identity to srr:SerAS9_3585)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>IAI46_18140 DMT family transporter (Serratia liquefaciens MT49)
MSARNNIDGKAGSAMVMICAIWGLQQVAIKAAEPDISAVLQIAIRSGIAALAVYLLARFK
GEKFLFDPRTLLAGFGVGLSFALEFFFVSEGLRYTSASHMAVFLYTAPLFSAIGLHFFIR
HERLSAVQWAGIAIAFGGVVLAISAMGESSGGVNQLRGDIYGLLAGLSWGGSTILIRTTG
LANCSSKQTLLFQLTGACIVLSLLAMTMQDVHFTLSSVAWSSLVFQTVIVSFISYLIWFS
LLRHYQASSLGILTFMTPIFGILAGVVILGEPLQIEFVLGSVLIVLGLIVVSCSYLFYFT
RRIAPKI