Protein Info for IAI46_18060 in Serratia liquefaciens MT49

Annotation: long-chain fatty acid transporter FadL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03349: Toluene_X" amino acids 17 to 440 (424 residues), 514.3 bits, see alignment E=1.1e-158

Best Hits

Swiss-Prot: 74% identical to FADL_SALTY: Long-chain fatty acid transport protein (fadL) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06076, long-chain fatty acid transport protein (inferred from 99% identity to spe:Spro_3381)

MetaCyc: 71% identical to long-chain fatty acid outer membrane channel / bacteriophage T2 receptor (Escherichia coli K-12 substr. MG1655)
RXN0-1802

Predicted SEED Role

"Long-chain fatty acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>IAI46_18060 long-chain fatty acid transporter FadL (Serratia liquefaciens MT49)
MSQKNLFTKSALAAAVAIISSNVSAAGFQLNEFSSAGLGRSYSGEGAMADTAASASRNPA
LLMMYTRPELSFGAVFIDPDVDISGKSPSGASLDSKNIAPTAWVPNLHYVQPINDQFAVG
GSVTSNYGLATEFNDGYTAGAYGGKTDLTTLNLNLSGAYRLNQQFSFGLGFDAVYAKAKL
ERYAGELPKLIAGSGQLPPQLAGPVSQIPADTQISHLKGDKWGFGWNAGILYEVDENNRY
GFTYRSEVKIKFDGDYKSSLPSAYNPLLGALGLPMGTDGTTIPGSLDLNLPEMWEISGYN
KVAPQWAIHYSLAYTSWSQFQELKATGNNGQTLFEKHEGFKDAYRIALGTTYFYDDNWTF
RTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTSYAFNKDASVDVGVSYMHGQKVTIKEGP
YTFESVGKAWLYGANFNYRF