Protein Info for IAI46_18035 in Serratia liquefaciens MT49

Annotation: endonuclease SmrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF01713: Smr" amino acids 98 to 171 (74 residues), 73.3 bits, see alignment E=7e-25

Best Hits

Swiss-Prot: 97% identical to Y3376_SERP5: UPF0115 protein Spro_3376 (Spro_3376) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 97% identity to spe:Spro_3376)

Predicted SEED Role

"FIG001674: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>IAI46_18035 endonuclease SmrB (Serratia liquefaciens MT49)
MKNKHPLSKDELQLFRESVVDAKKLRQDTIVHRKPKPVTKKVAPQRLLQEQVDASYYFSD
EYQPQLEEEGPTRYVRPGYSAFELKKLRRGDYSPELFLDLHGLTQMQAKQELGALIAACK
REHVHCACVMHGHGKHILKQQTPLWLAQHPDVLVFHQAPKEWGGSAAILLLVELAE