Protein Info for IAI46_18020 in Serratia liquefaciens MT49

Annotation: penicillin-insensitive murein endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF03411: Peptidase_M74" amino acids 36 to 269 (234 residues), 319.1 bits, see alignment E=9.7e-100

Best Hits

Swiss-Prot: 82% identical to MEPA_YERE8: Penicillin-insensitive murein endopeptidase (mepA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K07261, penicillin-insensitive murein endopeptidase [EC: 3.4.24.-] (inferred from 97% identity to spe:Spro_3373)

MetaCyc: 69% identical to peptidoglycan DD-endopeptidase/peptidoglycan LD-endopeptidase (Escherichia coli K-12 substr. MG1655)
3.4.-.-; 3.4.-.-

Predicted SEED Role

"Murein endopeptidase"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>IAI46_18020 penicillin-insensitive murein endopeptidase (Serratia liquefaciens MT49)
MKNWMLGILALMASGSALALTPWQKIDHPVAGAPQAVGGFANGCIIGAQPLPLNSPDYQV
MRPDQRRYFGHPDLLAFIQRLSSKASQRNLGTVLIGDMAMPAGGRFSSGHASHQSGLDVD
IWLQLPRQRWSAQQLLKPQPIDLVSSDGKQVVARQWQPQIESLIKAAAQDQEVTRIFVNP
AIKQRLCLDAGADRDWLHKVRPWFGHRAHMHVRLRCPAGSLECKEQDTPPPGDGCGAELA
SWFVPHQPSAKPGKPVPPPLPPTCQALLDNHFAAE