Protein Info for IAI46_17955 in Serratia liquefaciens MT49

Annotation: anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 18 to 35 (18 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 85 to 112 (28 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details amino acids 317 to 339 (23 residues), see Phobius details amino acids 351 to 369 (19 residues), see Phobius details PF03600: CitMHS" amino acids 22 to 311 (290 residues), 144.6 bits, see alignment E=2e-46

Best Hits

KEGG orthology group: None (inferred from 91% identity to spe:Spro_3360)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>IAI46_17955 anion transporter (Serratia liquefaciens MT49)
MSSNAVSRLIQPFLKDRFLHILLLVGVLMAAFNPQQLPALNSFIDWRTIITLLGLMLLTK
GVEVSGYFDFVGRKIINTLHSERRLALFLVFSAALLSSFLTNDVALFIVIPLTITLKKLS
SLPIGRLIIFQALAVNAGSLLTPIGNPQNILLWSKSSLSFLGFIGQMAPFGVVMLVSLLL
LTGFCFPARDIVKAPHTEGYPYQLRLLLSCVALYVIFLLCLDLDLPLYGLLAVFVGFLLL
ARRVLLQIDWSLIFVFIAMFIDVGLFTRLQAIQPWFADIATLGNGGIYALGIGLSQVISN
VPATILMLNYVPSSQLLAYAVNAGGFGLAIGSLANLIALRMADERKIWLKFHYFSLPLLV
WAGLLGWLLA