Protein Info for IAI46_17865 in Serratia liquefaciens MT49

Annotation: sensor histidine kinase N-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details PF08521: 2CSK_N" amino acids 22 to 170 (149 residues), 149.6 bits, see alignment E=8.9e-48 PF00512: HisKA" amino acids 248 to 311 (64 residues), 41 bits, see alignment E=2.5e-14 PF02518: HATPase_c" amino acids 362 to 469 (108 residues), 62.9 bits, see alignment E=5.6e-21

Best Hits

KEGG orthology group: None (inferred from 96% identity to srr:SerAS9_3537)

Predicted SEED Role

"Tricarboxylate transport sensor protein TctE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>IAI46_17865 sensor histidine kinase N-terminal domain-containing protein (Serratia liquefaciens MT49)
MRWFNAPQSLFYQLLLFFGLPLLVLGGISIYTHYFSAMNAATLAYDRTLLASARTVAERL
VVRNGRLEVDVPYVVLDSFERNMNDQLYYEVISPQGVSISGYDDLPTMPPHILRSSLYPA
LVHFYDAEYRGRPIRVAALYQPVNESGVMGMATILVAETLESRRYLARQMMFSALLSQGT
VVVLTMILAFALLKRVLKPMRKLSGIMLRRDPGELTPLPMVLPWSEMQPLLLAFNRYIER
LRVMVARQERFSADASHQLRTPLTVLKTQVGVALASDKPEQWRESLLAMSATLDNTVALT
DRLLYLSRLKAHEHHADRQLQPVNLAQVLRDACFSRLPQARSKRIDLGYEGESVCWVGGE
TLLLTELCANLLDNALKYTPHQGTVTARLTLDKQAGEGILEIEDSGPGIAQQDTAQALQP
FHRLDNVGDQPGAGLGLALVSDITRYHGTRPELLTSATLGGLLVRVRFQLLS