Protein Info for IAI46_17840 in Serratia liquefaciens MT49

Annotation: tRNA pseudouridine(38-40) synthase TruA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 13 to 249 (237 residues), 261.7 bits, see alignment E=3e-82 PF01416: PseudoU_synth_1" amino acids 19 to 114 (96 residues), 51.9 bits, see alignment E=4.7e-18 amino acids 153 to 255 (103 residues), 106.1 bits, see alignment E=6.7e-35

Best Hits

Swiss-Prot: 86% identical to TRUA_YERPE: tRNA pseudouridine synthase A (truA) from Yersinia pestis

KEGG orthology group: K06173, tRNA pseudouridine synthase A [EC: 5.4.99.12] (inferred from 96% identity to srs:SerAS12_3533)

MetaCyc: 81% identical to tRNA pseudouridine38-40 synthase (Escherichia coli K-12 substr. MG1655)
tRNA-pseudouridine synthase I. [EC: 5.4.99.12]

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>IAI46_17840 tRNA pseudouridine(38-40) synthase TruA (Serratia liquefaciens MT49)
MSEVVLPTQPTLKIALGIEYDGSRYYGWQRQQEVASVQACLEQALSKVANAPINVLCAGR
TDAGVHATGQVVHFETTAQRKDAAWTMGVNTHLPPDIAVRWVTGVPEDFHARFSATARRY
RYIIYNHRYRPAVLQQGMTHFYHPLDADRMERAAQALLGENDFTSFRAVQCQSRTPWRNV
KHVKVTRHGEYIVVDIKANAFVHHMVRNIVGSLMEIGCGNQDENWMAELLALKDRNLAAA
TARAEGLYLVSVDYPEHFALPRPPMGPLFLPDD