Protein Info for IAI46_17785 in Serratia liquefaciens MT49

Annotation: histidine ABC transporter ATP-binding protein HisP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 21 to 181 (161 residues), 127.2 bits, E=7.6e-41
• PF13304: AAA_21
  • amino acids 165 to 211 (47 residues), 27.8 bits, 2.4e-10

Best Hits

Swiss-Prot: 87% identical to HISP_ECOLI: Histidine transport ATP-binding protein HisP (hisP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to srr:SerAS9_3521)

Predicted SEED Role

"Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Protein Sequence (257 amino acids)

>IAI46_17785 histidine ABC transporter ATP-binding protein HisP (Serratia liquefaciens MT49)
MSENKLAVTELHKRYGEHEVLKGVSLAANAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
SISLNNEDIRMVRDKDGQLKVFDKKQLQLLRTRLTMVFQHFNLWSHMTVLENVMEAPVQV
LGLSKTEARERAIRYLDKVGIDERARGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQKLAEEGKTMVVVTHEMEFARHVSSHVIFLHKGLIEEQGPPAELF
GNPKSPRLQQFLSGALK