Protein Info for IAI46_17705 in Serratia liquefaciens MT49

Annotation: NADH-quinone oxidoreductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 46 to 182 (137 residues), 228.3 bits, E=1.5e-72
• PF01058: Oxidored_q6
  • amino acids 67 to 175 (109 residues), 94.1 bits, E=3e-31

Best Hits

Swiss-Prot: 100% identical to NUOB_SERP5: NADH-quinone oxidoreductase subunit B (nuoB) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 100% identity to srr:SerAS9_3504)

MetaCyc: 93% identical to NADH:quinone oxidoreductase subunit B (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NAD(P)/NADPH interconversion (4/6 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (224 amino acids)

>IAI46_17705 NADH-quinone oxidoreductase subunit B (Serratia liquefaciens MT49)
MDYTLTRIDPNGENDRYPLQKQEVVADPLDQQVHRTVYMGKLEHALHDMVNWGRKNSIWP
YNFGLSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYEQ
MLEPKWVISMGACANSGGMYDIYSVVQGVDKFLPVDVYIPGCPPRPEAYMQALMLLQESI
GKERRPLSWVVGDQGVYRANMQSERERKHGERIAVTNLRTPDEI