Protein Info for IAI46_17695 in Serratia liquefaciens MT49

Annotation: NADH-quinone oxidoreductase subunit NuoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01958: NADH-quinone oxidoreductase, E subunit
  • amino acids 23 to 167 (145 residues), 176.6 bits, E=1.7e-56
• PF01257: 2Fe-2S_thioredx
  • amino acids 24 to 167 (144 residues), 174.2 bits, E=7.6e-56

Best Hits

Swiss-Prot: 89% identical to NUOE_SALTI: NADH-quinone oxidoreductase subunit E (nuoE) from Salmonella typhi

KEGG orthology group: K00334, NADH dehydrogenase I subunit E [EC: 1.6.5.3] (inferred from 98% identity to srs:SerAS12_3503)

MetaCyc: 87% identical to NADH:quinone oxidoreductase subunit E (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NAD(P)/NADPH interconversion (4/6 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (167 amino acids)

>IAI46_17695 NADH-quinone oxidoreductase subunit NuoE (Serratia liquefaciens MT49)
MNAAAPQSGVDAFELSAEERDAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIA
EVLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAAIEKKLSIKPGQ
TTFDGRFTLLPTCCLGNCDKGPTMMIDEDTHSQLKPEDIETLLEQYQ