Protein Info for IAI46_17680 in Serratia liquefaciens MT49

Annotation: NADH-quinone oxidoreductase subunit NuoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00146: NADHdh
  • amino acids 17 to 317 (301 residues), 397.4 bits, E=2.2e-123

Best Hits

Swiss-Prot: 98% identical to NUOH_SERP5: NADH-quinone oxidoreductase subunit H (nuoH) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_3499)

MetaCyc: 91% identical to NADH:quinone oxidoreductase subunit H (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NADH to dimethyl sulfoxide electron transfer (2/2 steps found)
• NADH to fumarate electron transfer (2/2 steps found)
• NADH to hydrogen peroxide electron transfer (2/2 steps found)
• NADH to trimethylamine N-oxide electron transfer (2/2 steps found)
• nitrate reduction VIII (dissimilatory) (2/2 steps found)
• NAD(P)/NADPH interconversion (4/6 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Protein Sequence (325 amino acids)

>IAI46_17680 NADH-quinone oxidoreductase subunit NuoH (Serratia liquefaciens MT49)
MSWFTPEVIDILISVLKAVVILLVVVTCGAFMSFGERRLLGLFQNRYGPNRVGWGGSLQL
VADMIKMFFKEDWVPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSPTWAVSDLNIGILFFL
MMAGLAVYAVLFAGWSSNNKYSLLGAMRASAQTLSYEVFIGLSLMGVVAQADSFNMQTIV
ESQAHLWNVIPQFFGFVTFAIAGVAVCHRHPFDQPEAEQELADGYHIEYSGMKFGLFFVG
EYIGIVTVSALIVTLFFGGWQGPFLPPFIWFALKTAFFMMMFILIRAALPRPRYDQVMAF
GWKVCLPLTLLNLLATAAVILYNAQ