Protein Info for IAI46_17605 in Serratia liquefaciens MT49

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details PF00892: EamA" amino acids 3 to 131 (129 residues), 34.2 bits, see alignment E=1.3e-12 amino acids 144 to 271 (128 residues), 28 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 95% identity to spe:Spro_3292)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>IAI46_17605 DMT family transporter (Serratia liquefaciens MT49)
MVALWMVVASGFFALMGASIKLASAKVGFFDIIFYRSVINVLIVAALIHVKNLGFRTQHL
GLHMKRAAIGNAAMYCGFYSLIHLPIATATTLGYTNPIFQSAIAFVTSKGQLTGKLLFSV
LLGFIGILVLLRPDTPNGEYAATLIGLLSGLLTALAYFNVGKLVRSGEPELRVVFYFSLV
GTLVGGMMTSVVGFTALDSAMMLCVCAIGVFGSLGQITMTRAYGSGNAVIVSILSYSTII
FSTLLGYLLFGEKLSYIAAGGMALIILSGALAIVKRAPAKTSKAAAV