Protein Info for IAI46_17600 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 325 to 349 (25 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 369 (344 residues), 83.6 bits, see alignment E=1.3e-27

Best Hits

KEGG orthology group: None (inferred from 96% identity to spe:Spro_3291)

Predicted SEED Role

"Putative drug efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>IAI46_17600 MFS transporter (Serratia liquefaciens MT49)
MSEGVAVDEAAKAKLGESHFAILLFLALALMSALLNSSAPTPLYPLYQHELALSSVSLTV
IYGAYAAGVLISLFGVGNMAGKVKDLRSMIVPALLVVLAGALLFSMADSFLMMFMARLLA
GIGTGALTGAANIALVRFGPKDGGKNAALIATLSFTTGLALGPIFSGVALQTGFHTTSLP
FIIIMAVAAVAALGVMLKWPVEAVVVPLSGAPAAEAAAEKSSLADGLRATGGKFFLCAGA
LFICWAVAASILAIGPSVSEKLLGMHSRGVYGYVIAVYLVIAGISQILSRRVNARHSLMF
GCLAQALSVVVFAEAIQIHSLALASAGMVIAGYAYGAIFVGSATLVNLISPKASHARLIS
LFYVIAYIANWVPILLGAVIDHASLHLAVNLLFLVSAVVCLSLSFMVTRAGFPR