Protein Info for IAI46_17595 in Serratia liquefaciens MT49

Annotation: DUF1097 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 19 to 42 (24 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details PF06496: DUF1097" amino acids 8 to 141 (134 residues), 122 bits, see alignment E=1.1e-39

Best Hits

Swiss-Prot: 78% identical to YCDZ_ECOLI: Inner membrane protein YcdZ (ycdZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to spe:Spro_3290)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>IAI46_17595 DUF1097 domain-containing protein (Serratia liquefaciens MT49)
MNVLFAIAVTTGILSGVWGWVAVSLGLISWAGFLGCTAYFACPQGGLKGLLISTLTCCSG
VFWAMAIIHGSELAPGWSLLGYLLTGAVAFLMCIQAKQQWLGFVPGTFIGACATFAGGGN
WSLVTLSLLVGLVFGYAMKNSGLWLAARSEKPKPAAAVTEHVNR