Protein Info for IAI46_17590 in Serratia liquefaciens MT49

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF00356: LacI" amino acids 7 to 50 (44 residues), 61.4 bits, see alignment 1.1e-20 PF00532: Peripla_BP_1" amino acids 61 to 305 (245 residues), 74.4 bits, see alignment E=2.2e-24 PF13407: Peripla_BP_4" amino acids 63 to 262 (200 residues), 54.9 bits, see alignment E=2e-18 PF13377: Peripla_BP_3" amino acids 170 to 310 (141 residues), 81.1 bits, see alignment E=2.2e-26

Best Hits

Swiss-Prot: 50% identical to IDNR_ECOLI: HTH-type transcriptional regulator IdnR (idnR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_3485)

Predicted SEED Role

"Putative LacI-family transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>IAI46_17590 LacI family DNA-binding transcriptional regulator (Serratia liquefaciens MT49)
MKNQRVTLQDIALLAGVTKMTVSRYLRTPEKVAAETAEKIAQVMKEVNFTDGDEARSTQK
PRIGVLIPSFNNQIFADLLAGIESITLEQGYQTLVVNYDYSRQREEEHIVQLLAYPIAGL
ILTDSEHTLRAEKYLTAAKIPVAQVMDLEGPEGRIAVGFDNFQAGYDMTEALLASGKRQV
VYFGAMSDARDTKRFQGYCRAMEKQGLTPRQITPHRVSSVTVGSDMLAMARQLYPDLDGI
LCTNDDLAVGVLQECLRLGLRVPQDIALSGFHGLDIGKATTPGIASVITPRFDIGKVATE
ILLKRIKGVPCIERVDLHYRISLGGTI