Protein Info for IAI46_17560 in Serratia liquefaciens MT49

Annotation: 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR00173: 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase" amino acids 10 to 431 (422 residues), 458.7 bits, see alignment E=1.3e-141 PF02776: TPP_enzyme_N" amino acids 11 to 121 (111 residues), 67 bits, see alignment E=2.1e-22 PF16582: TPP_enzyme_M_2" amino acids 184 to 389 (206 residues), 282.5 bits, see alignment E=3.4e-88 PF02775: TPP_enzyme_C" amino acids 423 to 535 (113 residues), 30.8 bits, see alignment E=3.7e-11

Best Hits

Swiss-Prot: 96% identical to MEND_SERP5: 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase (menD) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02551, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC: 2.2.1.9] (inferred from 96% identity to spe:Spro_3283)

MetaCyc: 71% identical to 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase (Escherichia coli K-12 substr. MG1655)
synthase. [EC: 2.2.1.9]

Predicted SEED Role

"2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 2.2.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (557 amino acids)

>IAI46_17560 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase (Serratia liquefaciens MT49)
MSTSVFNRRWAALLLEALARHGVRHVCIAPGSRSTPLTLAAAANKSFICHTHFDERGLGH
LALGLAKASREPVAVIVTSGTAAANLYPSLIEAGLTGERLVFLTADRPPELINCGANQAI
RQNGLYASHPSLSLDLPRPTPDISASWLVSTLDSAMARLHHGALHINCPFAEPLYGGDEQ
QYDDWSATLGDWWQGSQPWLREMDPHVVLKQPDWFFWRQKRGVVVAGRMSAEEGEQVAQW
AAMLGWPLIGDVLSQTGQPLPCADLWLAQPQAQKRLADAQLVVQFGSSLTGKRLLQWQEQ
CQPQEYWLLDDLPGRLDPAHHRGRRIRSSVAQWLELHPAQPRTPWADELTQLADNALDAV
SGHLVNRFGEAQLAHRLPELLPENGQLFLGNSLIVRLIDALTRLPAGYPVFSNRGASGID
GLISTAAGVQRATAKPTLAVVGDLSALYDLNALALLRQCSAPTVLIVVNNNGGQIFSLLP
TPEEDRQRFYCMPQDVEFSHAAAMFQLAYARPENWGQLLQAVEQGWRHSGATLIELQVPP
SDGAQTLQHLVQQMAEQ