Protein Info for IAI46_17485 in Serratia liquefaciens MT49

Annotation: zinc-binding alcohol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08240: ADH_N
  • amino acids 25 to 128 (104 residues), 107 bits, E=9.4e-35
• PF01262: AlaDh_PNT_C
  • amino acids 163 to 196 (34 residues), 24.4 bits, 3.6e-09
• PF00107: ADH_zinc_N
  • amino acids 171 to 297 (127 residues), 87.7 bits, E=1.3e-28

Best Hits

KEGG orthology group: None (inferred from 74% identity to ect:ECIAI39_0670)

MetaCyc: 45% identical to L-galactonate 5-dehydrogenase (Phocaeicola vulgatus ATCC 8482)
RXN0-5229 [EC: 1.1.1.414]

Predicted SEED Role

"alcohol dehydrogenase, zinc-binding domain protein"

MetaCyc Pathways

• L-galactonate degradation (1/1 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.414

Protein Sequence (337 amino acids)

>IAI46_17485 zinc-binding alcohol dehydrogenase family protein (Serratia liquefaciens MT49)
MKALTIDKNSHTEFVDIPEAVCGDNDVLIDVQRVGLCGSDLNTYRGFNPLVVYPCIPGHE
ISGEVIRTGCNVTTAKPGDRVVVLPCTECGVCSSCLAGRPNACKHNQTLGVQRQGGMAQR
LVIPANKILVCNALSFDELALVEPLAVGLHAARRGAIQVGEWVAVIGCGVIGLGAIAAAA
AMGARVIAIDIDDRKQAVALACGACSFLNGAKVDLADELGRIDEGRGPALVIEAAGQTSS
IEQSLELVAFSGRIVYVGYAKKPVNYNSALFLLKEVDIRGSRNATVADFRAVLALMEQQR
YPLHSIITTHYPLDQAGEAFMAWAADPGAVTKILIAF