Protein Info for IAI46_17480 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 44 to 64 (21 residues), see Phobius details amino acids 76 to 104 (29 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 364 (354 residues), 198.6 bits, see alignment E=7.4e-63 amino acids 296 to 422 (127 residues), 34.3 bits, see alignment E=6.6e-13

Best Hits

KEGG orthology group: None (inferred from 46% identity to bgf:BC1003_1407)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>IAI46_17480 MFS transporter (Serratia liquefaciens MT49)
MKQRNKIITLLFIASIINYLDRAAFSVAMPYIKDYLQLSPAEIGVMLSSFFFGYALFNFV
GGYLSDIYGPRKVMAIAMLTWSLFCGLTGVAFSYIILFIIRVIFGMSEGPVSTNINKVIT
HWIPIHQRARAIGIANAGNPLGGAIAGPIVGFLIIMWNWRVAFIILMSLGFVWTFFWLKN
FTDHPKDHPKTQPIEIEEFETALHNAPVNHDTQTKLPFRFYLTQPLVLATGMAFFAINYI
LYFFLTWFPSYLSMAKGLNIAEMSIASSIPWLLGSVGMVMGGAVSDYIYKKSGRLLFSRK
LLIVVGLIASSVCICIAGIVDSVTFAVIMMSFGIFFMYLAASSPWSIISDSISADKVGGV
GGFVHLLANTSGMIAPILTGFIVQYSGGSFISAFVLAGVVGIFGALSVALFVKPINSNKK
AQPLTDTLTNLRKQ