Protein Info for IAI46_17465 in Serratia liquefaciens MT49

Annotation: bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 16 to 234 (219 residues), 294.8 bits, E=1.7e-92
• PF01209: Ubie_methyltran
  • amino acids 47 to 164 (118 residues), 35.7 bits, E=3.2e-12
• PF05175: MTS
  • amino acids 56 to 127 (72 residues), 28.3 bits, E=6.6e-10
• PF13489: Methyltransf_23
  • amino acids 57 to 197 (141 residues), 89.8 bits, E=8.2e-29
• PF06325: PrmA
  • amino acids 57 to 164 (108 residues), 31.8 bits, E=5.2e-11
• PF13847: Methyltransf_31
  • amino acids 58 to 168 (111 residues), 70.7 bits, E=6e-23
• PF05401: NodS
  • amino acids 58 to 181 (124 residues), 26.1 bits, E=3.6e-09
• PF02353: CMAS
  • amino acids 58 to 192 (135 residues), 39.4 bits, E=2.3e-13
• PF13649: Methyltransf_25
  • amino acids 60 to 153 (94 residues), 71.8 bits, E=3.2e-23
• PF08241: Methyltransf_11
  • amino acids 61 to 157 (97 residues), 77.8 bits, E=4.3e-25
• PF08242: Methyltransf_12
  • amino acids 61 to 155 (95 residues), 61.7 bits, E=4.7e-20

Best Hits

Swiss-Prot: 95% identical to UBIG_SERP5: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 95% identity to spe:Spro_3270)

MetaCyc: 78% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Protein Sequence (241 amino acids)

>IAI46_17465 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG (Serratia liquefaciens MT49)
MNAESSSQAQNVDHQEIAKFEAVASRWWDLEGEFKPLHRINPLRLNYILQRSGGIFDKTV
LDVGCGGGILAESMAREGAKVTGLDMGAEPLQVARLHALETGMNVNYVQETVESHAQANP
QKYDVVTCMEMLEHVPDPASVVRACAHLVKPGGHVFFSTINRNTKAWLMAVIGAEYILKM
VPQGTHDHKKFIRPSELIGWIDHTPLREKHMIGLHYNPITDHFKLGGNVDVNYMVHTQHE
G