Protein Info for IAI46_17440 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 322 (301 residues), 61.9 bits, see alignment E=2.7e-21

Best Hits

Swiss-Prot: 74% identical to Y1221_YERPE: Uncharacterized MFS-type transporter YPO1221/y2967/YP_0917 (YPO1221) from Yersinia pestis

KEGG orthology group: None (inferred from 94% identity to spe:Spro_3265)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>IAI46_17440 MFS transporter (Serratia liquefaciens MT49)
MTSTLCNEQQKPGIPAQIATRLAFFVAGFGMAAWAPLVPFAKARIGIDDGSLGLLLLCIG
AGSMLAMPLTGFLTGRLGCRPVILLAGLALCIDLPLLVLMNTTLGMALALLLFGAAIGMI
DVAMNIQAVVVERASGKAMMSGFHGFFSVGGIAGAGGVSIMLWLGLSPLLATCVTVLTIA
ALLTVASRNLLRESGGEEGGPMFVVPRGWVMFIGILCFIMFLAEGSMLDWSALFLTTLRG
VDHSQAGLGYALFSITMTLGRLNGDRIVNALGRYKVLLLGSLCAAIGLSMAIVFDNAMVS
LIGFMLVGLGASNVVPILFSAAGNQHDMPANLAIASVTTVGYAGILAGPALIGFIAQFSS
LTVAFACVAVLLLAVTASARAITR