Protein Info for IAI46_17395 in Serratia liquefaciens MT49

Annotation: PepSY domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 32 to 56 (25 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details amino acids 423 to 456 (34 residues), see Phobius details PF03929: PepSY_TM" amino acids 31 to 397 (367 residues), 224.1 bits, see alignment E=1.8e-70

Best Hits

KEGG orthology group: None (inferred from 84% identity to srs:SerAS12_3456)

Predicted SEED Role

"Uncharacterized iron-regulated membrane protein; Iron-uptake factor PiuB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>IAI46_17395 PepSY domain-containing protein (Serratia liquefaciens MT49)
MSERNIALPAAAQNINPQVTTRSWFIPLAMRIHFYIGFFVGPFLLIAALSGIFYALTPQI
ESRLYAPQLYNDNTGPALPLKQQIMAAQAIAPSKASLSAVRPSPAEGENTRVLFNVAGLQ
ASERLAVFVDPVTAQTHGVMTVYGTSGVLPLRTWLDQFHRSLLLGDVGRNYSELAASWLW
IAALGGLILWGARRRKKVTRQRGGLRRLHEKSGVLLLVGLLFFSATGLTWSQWAGENISV
LRQQFGWSTPSLSTAINGQDAVPAGDHAEHHEHMMVRAEPPQDGAMYDRALVGARQAGID
AARVEIKQPAMAGQAWTVMEIDRRWPTQVDAVAIDPVTLAITDRVSFEQYPLAAKLTRWG
IDLHMGVLFGLVNELVLVVFAAGLVAMVVMGYLMWWRGRPTRVVRKPARSPFMLLRKTPK
GPLLLIVCLTLLLGFCLPVMGVSLLMFLLCDLLWYLATRRRKPHLSTK