Protein Info for IAI46_17340 in Serratia liquefaciens MT49

Annotation: Bcr/CflA family multidrug efflux MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 288 to 338 (51 residues), see Phobius details amino acids 350 to 369 (20 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 15 to 396 (382 residues), 464 bits, see alignment E=2.6e-143 PF07690: MFS_1" amino acids 22 to 364 (343 residues), 176.4 bits, see alignment E=8.3e-56 PF00083: Sugar_tr" amino acids 54 to 194 (141 residues), 40.3 bits, see alignment E=1.9e-14

Best Hits

Swiss-Prot: 69% identical to BCR_ECOLI: Bicyclomycin resistance protein (bcr) from Escherichia coli (strain K12)

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 98% identity to spe:Spro_3251)

MetaCyc: 69% identical to multidrug efflux pump Bcr (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-340; TRANS-RXN-44

Predicted SEED Role

"MFS family multidrug transport protein, bicyclomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>IAI46_17340 Bcr/CflA family multidrug efflux MFS transporter (Serratia liquefaciens MT49)
MKESLNVQQNRSSHLGLIFILGLLSMLMPLAIDMYLPSMPVIAKQFGVEAGSVQMTLSAY
MLGFALGQLFYGPMSDSIGRKPVILWGTLIFAIAGGACAMAQSIDQLINLRFLHGLSAAA
ASVVINALMRDMFTKDEFSRMMSFVILVMTIAPLLAPMIGGALLLWFSWHAIFWTMGAAA
LIGSLLVAFFIKETLPKERRQKFHLRTTLGNFASLFRHKRVLSYMLASAFSFAGMFSFLS
AGPFVYIELNHVSPQHFGYYFALNIVFLFLTTLVNSRNVRRLGAIKMFRLGLFVQLAMGL
WLLAVSAIGLGFWALVLGVAVYLGCIAMISSNAMAVILDDFPHMAGTASSLAGTLRFSIG
ALVGAVLAMAPGKSAWPMVSSMALCSIVAVLFYLYASRPRHKASPNTP