Protein Info for IAI46_17275 in Serratia liquefaciens MT49

Annotation: elongation factor P-like protein YeiP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02178: elongation factor P-like protein YeiP
  • amino acids 3 to 189 (187 residues), 323 bits, E=3.8e-101
• PF08207: EFP_N
  • amino acids 3 to 61 (59 residues), 55.4 bits, E=7.6e-19
• PF01132: EFP
  • amino acids 70 to 125 (56 residues), 47.5 bits, E=2.1e-16
• PF09285: Elong-fact-P_C
  • amino acids 133 to 188 (56 residues), 69.7 bits, E=2.1e-23

Best Hits

Swiss-Prot: 98% identical to EFPL_SERP5: Elongation factor P-like protein (Spro_3237) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02356, elongation factor P (inferred from 98% identity to spe:Spro_3237)

Predicted SEED Role

"Translation elongation factor P-related protein"

Protein Sequence (190 amino acids)

>IAI46_17275 elongation factor P-like protein YeiP (Serratia liquefaciens MT49)
MAKANEIKRGMAINYNGKLLLVKDIDVQSPSARGASTLYKMRFSDVRTGLKVEERFKGDD
ILDTISLSRRKVNFSYIDGEEYVFMDDEDYTPYIFKKDQIEDELLFIPEGGLPGMQVLTL
DGQVLALELPQTVDMEIVDTAPGIKGASASARNKPATMATGLTIQVPEYLSAGDKIRIHI
AERRYMSRAD