Protein Info for IAI46_17270 in Serratia liquefaciens MT49

Annotation: tryptophan permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 41 to 42 (2 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 387 to 411 (25 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 11 to 402 (392 residues), 481 bits, see alignment E=1.6e-148 TIGR00837: aromatic amino acid transport protein" amino acids 16 to 395 (380 residues), 482.4 bits, see alignment E=5.8e-149

Best Hits

Swiss-Prot: 61% identical to MTR_PSEAB: Tryptophan-specific transport protein (mtr) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K03835, tryptophan-specific transport protein (inferred from 95% identity to srs:SerAS12_3378)

MetaCyc: 60% identical to tryptophan:H+ symporter Mtr (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-142; TRANS-RXN-76

Predicted SEED Role

"Tryptophan-specific transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>IAI46_17270 tryptophan permease (Serratia liquefaciens MT49)
MSADTIQKLSRPSVLGGAMIIAGTAVGAGMFSIPIVTSGVWFSGSVALLVYTWACMLISG
LMILEAALHYPSGASFHTIVKDLLGKGWNAINGISIAFVLYILTYAYISAGGSIIAHTLE
GIVGVGQSTAGLVFAVVVAFIVWLSTRAVDRLSTILIGGMVITFVMSVGDMFTHVQPAVL
FNRGDDQASYLPYALAALPYLLTSFGYHGNVPGLVKYYHKDSGAVVRSLVYGTLLALAIY
ILWQYVIQGNIARDAFKQVIAEGGNIGSLLKQMGNVSSSQTVGQLLNAFSYMALASSFLG
VSLGLFDYLADFFKFSDDTVGRSKTALVTFAPPTIAALLFPNGFLYAIGFAGLAATVWAV
IVPAMMARASRRRFTEAQYRAPGGYGMILFIILFGVINAVAHVLALLGLLPVFE