Protein Info for IAI46_17260 in Serratia liquefaciens MT49

Annotation: sugar efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 252 to 275 (24 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details TIGR00899: sugar efflux transporter" amino acids 18 to 391 (374 residues), 586.8 bits, see alignment E=9.6e-181 PF07690: MFS_1" amino acids 20 to 355 (336 residues), 125.6 bits, see alignment E=1.1e-40 amino acids 220 to 388 (169 residues), 60.8 bits, see alignment E=5.6e-21

Best Hits

Swiss-Prot: 73% identical to SOTA_DICCH: Sugar efflux transporter A (sotA) from Dickeya chrysanthemi

KEGG orthology group: K03291, MFS transporter, SET family, sugar efflux transporter (inferred from 97% identity to spe:Spro_3234)

MetaCyc: 71% identical to sugar exporter SetB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-82

Predicted SEED Role

"Sugar efflux transporter B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>IAI46_17260 sugar efflux transporter (Serratia liquefaciens MT49)
MPTSTAVTRRSPDLTSLAFLVVAFLTGIAGALQTPTLSLFLATEVKVRPSMVGLFFTGSA
VIGILVSQFLARRSDQKGDRKTLIFLCCMLGALGCVLFAWNRNYYLLLAVGVMLTSFGST
ANPQMFALAREHADRTGREAVMFSSILRAQVSLAWVIGPPIAFALALGFGFKVMYLAAAA
AFILCGVLVWKMLPSMRKTPVASSTTLEAPRKNRRDTLLLFLTCTFMWTANSMYLINMPL
YMVHELQLPERLAGILMGTAAGLEIPTMLLAGMVAKRFGKRFLMRCAVAAGLLFYFGLLF
ITGTWQLIALQLLNAAFIGVLAGIGMLYFQDLMPGQAGAATTLFTNTTRVGWIFAGSIAG
VVAEVWNYHAVFYSALAMVVGAVLCLWKLKDA