Protein Info for IAI46_17250 in Serratia liquefaciens MT49

Annotation: NapC/NirT family cytochrome c

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03264: Cytochrom_NNT
  • amino acids 11 to 182 (172 residues), 235.1 bits, E=8.4e-74

Best Hits

Swiss-Prot: 42% identical to TORC_ECO57: Cytochrome c-type protein TorC (torC) from Escherichia coli O157:H7

KEGG orthology group: K03532, trimethylamine-N-oxide reductase (cytochrome c) 1, cytochrome c-type subunit TorC (inferred from 98% identity to spe:Spro_3232)

MetaCyc: 42% identical to cytochrome c menaquinol dehydrogenase TorC (Escherichia coli K-12 substr. MG1655)
RXN0-5264

Predicted SEED Role

"Cytochrome c-type protein TorY" in subsystem trimethylamine N-oxide (TMAO) reductase

MetaCyc Pathways

• NADH to trimethylamine N-oxide electron transfer (2/2 steps found)
• formate to trimethylamine N-oxide electron transfer (2/2 steps found)
• hydrogen to trimethylamine N-oxide electron transfer (1/2 steps found)

Protein Sequence (386 amino acids)

>IAI46_17250 NapC/NirT family cytochrome c (Serratia liquefaciens MT49)
MTNKLTGLIKKHRWGWLWILLLGIILGAALLAGTATVFHKTSDTAFCVSCHTMQQPLAEY
QGSVHFQNTKGIRAECADCHVPHEPLDYLWTKIRAVKDIYGEMVGTIDTPEKYEAHKLAM
AQSVWKTLKENDSATCRSCHSFDAMDITAQRPEARIQHPVAIKQGETCIDCHKGVAHILP
DMSGAAQAGAAELAKAAAETSPTATTLYTIATEPFFLKPDDSHNAGNLMPSTEVQVVKQE
GDKVLANVTGWQQDGVAEVFYAAQGKRILSVLLGEDARKLLKTGTTMTDAETGLVWHQVS
LQVWLPRKQLIDDQQKIWRYTADMMSANCTGCHGLTALDRFNANQWIGVIKGMAPRTSLT
QEQLRVLTQYVQKHASDMQPAAPAKL