Protein Info for IAI46_17235 in Serratia liquefaciens MT49

Annotation: 1-phosphofructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03168: hexose kinase, 1-phosphofructokinase family
  • amino acids 5 to 308 (304 residues), 326.5 bits, E=1.3e-101
• TIGR03828: 1-phosphofructokinase
  • amino acids 5 to 308 (304 residues), 331.4 bits, E=4.6e-103
• PF00294: PfkB
  • amino acids 14 to 292 (279 residues), 228.3 bits, E=6.9e-72

Best Hits

Swiss-Prot: 92% identical to K1PF_SHIFL: 1-phosphofructokinase (fruK) from Shigella flexneri

KEGG orthology group: K00882, 1-phosphofructokinase [EC: 2.7.1.56] (inferred from 100% identity to spe:Spro_3229)

MetaCyc: 92% identical to 1-phosphofructokinase (Escherichia coli K-12 substr. MG1655)
1-phosphofructokinase. [EC: 2.7.1.56]

Predicted SEED Role

"1-phosphofructokinase (EC 2.7.1.56)" in subsystem Fructose utilization (EC 2.7.1.56)

MetaCyc Pathways

• superpathway of hexitol degradation (bacteria) (16/18 steps found)
• fructose degradation (1/1 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (3/4 steps found)
• N-acetyl-D-galactosamine degradation (3/5 steps found)
• galactitol degradation (3/5 steps found)
• lactose degradation I (2/5 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.56

Protein Sequence (313 amino acids)

>IAI46_17235 1-phosphofructokinase (Serratia liquefaciens MT49)
MSRRVATITLNPAYDLVGFCPEIERGEVNLVKTAGLHAAGKGINVAKVLKDLGIDVTVGG
FLGKDNQDGFQLLFSDLGIANRFQVVPGRTRINVKLTEKDGEVTDFNFSGFEVSGQDWER
FVTDSLSWLGQFDMVAVSGSLPAGVDPDAFTDWMIRLRAQCPCIIFDSSREALVAGLKAA
PWLVKPNRRELEIWAGRPLPQLADVVEAAHALRDQGIAHVVISLGAEGALWVNASGAWIA
KPPACEVVSTVGAGDSMVGGLIYGLLMRESSEHTLRLATAVAALAVSQSNVGVTDRPQLA
AMMARVDLKPFNQ