Protein Info for IAI46_17230 in Serratia liquefaciens MT49

Annotation: PTS fructose transporter subunit IIBC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 transmembrane" amino acids 235 to 256 (22 residues), see Phobius details amino acids 267 to 292 (26 residues), see Phobius details amino acids 304 to 329 (26 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 414 to 442 (29 residues), see Phobius details amino acids 463 to 482 (20 residues), see Phobius details amino acids 489 to 511 (23 residues), see Phobius details amino acids 519 to 548 (30 residues), see Phobius details TIGR00829: PTS system, Fru family, IIB component" amino acids 107 to 190 (84 residues), 133.4 bits, see alignment E=2.7e-43 PF02302: PTS_IIB" amino acids 108 to 196 (89 residues), 73.7 bits, see alignment E=1.5e-24 TIGR01427: PTS system, Fru family, IIC component" amino acids 216 to 552 (337 residues), 478 bits, see alignment E=2.1e-147 PF02378: PTS_EIIC" amino acids 233 to 496 (264 residues), 67 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 79% identical to PTFBC_ECOLI: PTS system fructose-specific EIIB'BC component (fruA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to srr:SerAS9_3369)

MetaCyc: 79% identical to fructose-specific PTS multiphosphoryl transfer protein FruA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component" in subsystem Fructose utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (562 amino acids)

>IAI46_17230 PTS fructose transporter subunit IIBC (Serratia liquefaciens MT49)
MKTLLMIDNSLGQARSHLAKRMLGAAAVKTGLTLVESAADAELVVVAGQTVPADAALNGK
RVYVGDVAHAVREPEAFLAQAMAEAKAYQAPAAAVVEPAAAGQKRIVAITACPTGVAHTF
MAAEAIESEAKKRGWWVKVETRGSVGAGNAITPEEVAAADLVIVAADIEVDLDKFAGKPM
YRTSTGLALKKTAQELDKAQAEAEIFQPQKSGAPATAGKKKESAGPYRHLLTGVSYMLPM
VVAGGLCIALSFVFGIKAFEVKGTLAAALMQIGGGSAFALMVPVLAGFIAFSIADRPGLT
PGLIGGMLAVSTGAGFLGGIIAGFLAGYVAKFISTKLRLPQSMEALKPILIIPLVASLIV
GLIMIFIVGTPVAKIMEGLTHWLQSLGTANAVLLGAILGAMMCTDMGGPVNKAAYAFGVA
LLSSSVYAPMAAIMAAGMVPPLAMGLATLLARRKFEKSEQEGGKAALVLGLCFISEGAIP
FAARDPMRVLPCCIAGGALTGALSMAFGAKLMAPHGGLFVLLIPGAITPVLLYLVAIVAG
TLLAGVSYALLKRAEVPAATVA