Protein Info for IAI46_17185 in Serratia liquefaciens MT49

Annotation: ligand-gated channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 664 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07715: Plug" amino acids 44 to 154 (111 residues), 106.4 bits, see alignment E=1.7e-34 PF00593: TonB_dep_Rec" amino acids 284 to 637 (354 residues), 203.4 bits, see alignment E=1.8e-63 PF14905: OMP_b-brl_3" amino acids 446 to 647 (202 residues), 55.1 bits, see alignment E=1.1e-18

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 94% identity to spe:Spro_3220)

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (664 amino acids)

>IAI46_17185 ligand-gated channel protein (Serratia liquefaciens MT49)
MEKPRYNKLTALIIATLTSAGAVAAQPDAQDTMVVTASGFQQKIQDSPASISVIPRQQIE
DKAYRDITDALKDVPGVVVTGGGSSSDISIRGMSSKYTLILVDGKRVDTRGTRPNSDNAG
IEQGWLPPLEAIERIEVVRGPMSSLYGSDAMGGVINVITRKTSTTQAWKGSLHGDATFQE
NSNSGDIFQTNAYASGPLIEGLLGLRVNGLLSRRAEDQILNGFNEQRMRSGTAVFSLTPN
EQNDFDFEIGRSLQDRNSTPGKSMATENCRNKKCTPNSASDSLYTRTNYAVTHNGYYDFG
NTTSYIQREETNNPGRDMKMYNTIFNTQTQFDLGSHMLNLGGQYRYEKLSDGGNQLAAAD
KLNQLTRWSWALFAEDEWAMTNDFSLTSGIRMDQDQNYGNHWTPRMYGVWHLTEQFTLKG
GVSAGYRSPDLRQSSAGWGQITGGGRTSIIIGNPDLKPEKSLSEEIGVMWDNLQGLNASV
TLFNTDFKDKITEVRRCDSGDGDAQCMIGNTPYYFISDRTNVDKANMRGVEATFGWEITK
DWQLTTNYTYTTSEQKSGDFQGKPLNQMPKHMVNSVLDWQATHDVSLWSRVNFRSKTSDY
MSRSSMAKSTPSYTFVDAGLSYQANKNLMVTGGVYNILDKTVDYDNYNTVLDGRRYTVGM
TYNF