Protein Info for IAI46_17155 in Serratia liquefaciens MT49

Annotation: APC family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 397 to 415 (19 residues), see Phobius details amino acids 421 to 439 (19 residues), see Phobius details PF00324: AA_permease" amino acids 26 to 417 (392 residues), 125.1 bits, see alignment E=3.2e-40 PF13520: AA_permease_2" amino acids 56 to 415 (360 residues), 122.8 bits, see alignment E=1.9e-39

Best Hits

Swiss-Prot: 78% identical to PLAP_ECO57: Low-affinity putrescine importer PlaP (plaP) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to srr:SerAS9_3354)

MetaCyc: 78% identical to putrescine:H+ symporter PlaP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-69

Predicted SEED Role

"Putrescine importer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>IAI46_17155 APC family permease (Serratia liquefaciens MT49)
MSDNIISAAPAQRAQLRKTLTLVPVVMMGLAYLQPMTIFDTFGIVSGLTDGHVATAYAFA
LLAVLFTALSYGKLVRKFPSAGSAYTYAQKAISPHVGFMVGWSSLLDYLFMPMINILLAK
IYLEAIFPGVPSWIFVAALVGLMTIFNLRGIKLVANLNSIIVVVQVAIMIVFLFLVVNGI
SHGEGAGTLISSRPFWSENAHVVPMITGATILCFSFLGFDGISSLSEETKDAENVIPKAI
FLTALIGGIIFIVVSYFVQLYFPDISRFKDPDASQPEIMLYVAGKFFQSVILVFSCVTVL
ASGMASHAGVSRLMYVMGRDGVFPERFFGYVHPKWRTPALNVLLVGVIALSAVSFDLVTA
TALINFGALVAFTFVNLSVISQFYIRDKLNRTVKDTFNYLILPVLGALTVGALWINLEAS
SMTLGLVWAAIGLIYLAFVTRSFRLPVPQASEDVA