Protein Info for IAI46_17110 in Serratia liquefaciens MT49

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01096: lysine-arginine-ornithine-binding periplasmic protein" amino acids 8 to 253 (246 residues), 266 bits, see alignment E=1.6e-83 PF00497: SBP_bac_3" amino acids 29 to 254 (226 residues), 205.7 bits, see alignment E=6.9e-65

Best Hits

Swiss-Prot: 52% identical to ARGT_ECOLI: Lysine/arginine/ornithine-binding periplasmic protein (argT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to srr:SerAS9_3344)

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>IAI46_17110 ABC transporter substrate-binding protein (Serratia liquefaciens MT49)
MKTKISLVLLLPLALSFAVSAGEFSGKVIKLGVDPTYPPLEFKTPQGALTGFGVDIAQAM
CEQMQAKCVWVESSWDGMIPGLLAKKFDAIASSMTITPQRQAQIAFSDKVSNAPARLVAR
KGSNLQPTAASLKGKSIGVQQGSSQETYANALWRPAGVNVVSYQSQQEANEDLINGRLDA
SLLASVSASEFFHTPAGKDFAFIGAELSDSKYFGIGDGIGLRKEDIALRNAFNAALQAII
ANGTYKKVNDKYFDFDVYGAGH