Protein Info for IAI46_17105 in Serratia liquefaciens MT49

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01891: amidohydrolase
  • amino acids 17 to 376 (360 residues), 368.9 bits, E=1.5e-114
• PF01546: Peptidase_M20
  • amino acids 75 to 385 (311 residues), 160 bits, E=8e-51
• PF07687: M20_dimer
  • amino acids 187 to 282 (96 residues), 45 bits, E=9.1e-16

Best Hits

Swiss-Prot: 38% identical to ILL5_ARATH: IAA-amino acid hydrolase ILR1-like 5 (ILL5) from Arabidopsis thaliana

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 90% identity to spe:Spro_3206)

MetaCyc: 40% identical to N-acetyl amino acid acetylase (Bacillus subtilis subtilis 168)
3.5.1.-

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

MetaCyc Pathways

• S-(2-succinyl)-L-cysteine degradation (3/4 steps found)
• S-benzyl-L-cysteine degradation (2/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Phenylalanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.32

Protein Sequence (389 amino acids)

>IAI46_17105 amidohydrolase (Serratia liquefaciens MT49)
MNNPLVLPEIAAVKHEMVAIRRHIHAHPELGFNEFATGELVAKLLSNWGYQVTRELGQTG
VVATLRRGSGKSLGLRADMDALPIEETSGLSYTSTHRGVMHACGHDGHTTMLLAAARYLA
QHSDFTGTLHLIFQPAEEGGGGARVMIEDGLFERFPCDAVFAMHNVPGFPVGQLGFASGA
FMCSADTVNITLHGHGGHGAVPQHTVDPVVVCAAIVMSLQTIVSRNIDPQETAIVTVGAI
QAGRAANVIPATATMTLSVRALDEGVRQRLENRITALVEAQAASFGARADIDYQQGYPVL
VNHVAETELARTVALDWAGEQQLIPSLRPFTASEDFAFMLEKCPGSYISIGNGESTPGNS
LHNAGYDFNDECLPIGATYWVKLVERFLA