Protein Info for IAI46_17055 in Serratia liquefaciens MT49

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF00356: LacI" amino acids 19 to 62 (44 residues), 46.2 bits, see alignment 4.6e-16 PF00532: Peripla_BP_1" amino acids 75 to 272 (198 residues), 56.3 bits, see alignment E=5.6e-19 PF13377: Peripla_BP_3" amino acids 185 to 338 (154 residues), 49.9 bits, see alignment E=6.3e-17

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 92% identity to spe:Spro_3197)

Predicted SEED Role

"transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>IAI46_17055 LacI family DNA-binding transcriptional regulator (Serratia liquefaciens MT49)
MAKKPGSTPAPAARKATASDVAARAGVSKWTVSRAFTDGASISPQAMQRVQTAARELGYR
PNLLARSLSKKSTRIIGLVADELKNPHIFTLLDEVTRQLQSRGYMALLLNITSEHDYESV
LTLADQMQVDGLLFLGTLLNDRLISLAQDIHRIPLVVLYRYSESPYIQVLATHGYQAGFD
IGELLLQQDYPRMGYLAGPISESTQLRRLDGFRAALAQQQREVNLVLQAPHYQRLCGMEA
FSAYLAATPAEQRIDAIFCENDILAVGVIDAIRATPGCAPIAVVGFDDIELAASPSYQLT
TYRQPMQQLIADGIHCLTQAFEPGGQRLYTGELIVRQSHLKQP