Protein Info for IAI46_16995 in Serratia liquefaciens MT49

Annotation: citrate (pro-3S)-lyase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details TIGR01588: citrate (pro-3S)-lyase, beta subunit" amino acids 8 to 295 (288 residues), 448.2 bits, see alignment E=5.1e-139 PF03328: HpcH_HpaI" amino acids 11 to 230 (220 residues), 280 bits, see alignment E=1.2e-87 PF15617: C-C_Bond_Lyase" amino acids 193 to 295 (103 residues), 34.4 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 83% identical to CITE_ECOLI: Citrate lyase subunit beta (citE) from Escherichia coli (strain K12)

KEGG orthology group: K01644, citrate lyase subunit beta / citryl-CoA lyase [EC: 4.1.3.34 4.1.3.6] (inferred from 99% identity to spe:Spro_3169)

MetaCyc: 83% identical to citrate lyase beta subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Citrate lyase beta chain (EC 4.1.3.6)" (EC 4.1.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.34, 4.1.3.6

Use Curated BLAST to search for 4.1.3.34 or 4.1.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>IAI46_16995 citrate (pro-3S)-lyase subunit beta (Serratia liquefaciens MT49)
MKTLNKHRLRRSMLFVPGANAAMVSNAFIYQADALMFDLEDSVILREKDAARRLVYHALQ
HPLYQEVETIVRVNALDSAYGLADLQAVVRGGADIVRLPKTDSAQDVVDMDREIAAIEAD
CGRPVGSTGLLAAIESAAGITQAVAIAHASPRLIGIALGAEDYVRNLRTERSPEGIELLF
ARCSILQAARAAGIQAFDTVYSDANNETGFLQEAALIKQLGFDGKSLINPRQIELLHNLY
APTAKEVAHAQRVVDAAAAAEQEGRGVVSLNGKMVDSPVIERARLVLQRAALSGIREASV
QHGEEA