Protein Info for IAI46_16950 in Serratia liquefaciens MT49

Annotation: EamA family transporter RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 5 to 22 (18 residues), see Phobius details amino acids 34 to 51 (18 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details PF00892: EamA" amino acids 3 to 139 (137 residues), 30.7 bits, see alignment E=1.7e-11 TIGR00688: protein RarD" amino acids 3 to 255 (253 residues), 197.1 bits, see alignment E=1.8e-62

Best Hits

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 95% identity to spe:Spro_3162)

Predicted SEED Role

"Chloramphenicol-sensitive protein RarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>IAI46_16950 EamA family transporter RarD (Serratia liquefaciens MT49)
MIKGIVLSVIASVLFGVMYYYTSTLTPLDGEQVFGWRTLLTVPFLTLFMVLSADWRKVSE
TLSWIKQRPRRLLFLPLSSALLGVQLWLFLWAPLHGKALEVSLGYFLLPLTMVLAGRLIF
RDRLSLLQKLAVSCAIIGVGNELYQVGGVSWTTLLVALGYPVYFILRRRFGTDNLGGLWC
ELTLMLPVAACFAFGGNGPLAALSISPALYWQIPLLGVISAAALVCYILASRLLPFSLFG
LLSYVEPVLLVVVALLLGESIGRDEWLTYIPIWLAVLLLVSEGASHLLRRRRIHRQM