Protein Info for IAI46_16930 in Serratia liquefaciens MT49

Annotation: L-idonate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF08240: ADH_N" amino acids 31 to 142 (112 residues), 110.7 bits, see alignment E=6.6e-36 PF16912: Glu_dehyd_C" amino acids 170 to 278 (109 residues), 38.8 bits, see alignment E=1.4e-13 PF00107: ADH_zinc_N" amino acids 184 to 309 (126 residues), 86.3 bits, see alignment E=3.6e-28

Best Hits

KEGG orthology group: None (inferred from 72% identity to dda:Dd703_0944)

Predicted SEED Role

"L-idonate 5-dehydrogenase (EC 1.1.1.264)" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.1.264)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.264

Use Curated BLAST to search for 1.1.1.264

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>IAI46_16930 L-idonate 5-dehydrogenase (Serratia liquefaciens MT49)
MSKRTLSCKACFAYGEKDVRVEQRELEYDENDVLVKVERGGICGSDIHYYQHGRAGMSIL
KQPMVVGHEFVGTVSQVPAGSALRVGQRVAVNPSQPCNHCEYCLAGKQNLCSTMRFMGSA
QFTPHVNGGFSEYVVATEQQCFAYRDDVAPQVMAFAEPLAVAIHAVNVAGTLVGKRVLVI
GAGPIGCLILAAARSAGASELVASDVSERCLELARHMGATATFNPLNECNSVAYQDNKGY
FDVVFEASGSPAAISSTIALTRPAGTVVQVGMGASNVDYPVMAMLVKEIRWVGSFRFVDE
FATAVKWLQDGRIDPLPLLSGEYPPEAIENALIAAADKSLSSKVQITF