Protein Info for IAI46_16905 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 12 to 16 (5 residues), see Phobius details transmembrane" amino acids 17 to 30 (14 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 379 (358 residues), 193.9 bits, see alignment E=1.9e-61

Best Hits

KEGG orthology group: None (inferred from 79% identity to ebi:EbC_22240)

Predicted SEED Role

"2-ketogluconate transporter" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>IAI46_16905 MFS transporter (Serratia liquefaciens MT49)
MNINLPVKLAPIRWRKLIPLAFITYSLAYLDRANYGFGAAAGLAQDLNITPGMSSLLGAL
FFLGYFFFQVPGGIYAEKRSAKALIFWSLVLWGILATATGLVSNVATLAVIRFLLGVAES
VVMPAMLVFLSHWFTKQERSKANTFLFLGNPITVLWMSILSGYLVDAFGWRGMFIIEGVP
AIIWAAIWWVIFVDRPKDATWLSEQEKTDLEAALAAEQTGMQPIKNYGEAFRSRKVLALS
FIHFFWNIGMYGFIMWLPSILKTASGMGIVATGWLSAAPYLLAVPLMLSVSYFSDKYQQR
KPVVLLFLGLGAVCFCASFTLGANHFWLSYVLLVIAGGAMYTPYGPFFAAIPELLPRNVM
AGAMAFIVSFGALGSFVGAWIVGYLNGITQGPQASYVFMGSSLVIAVVLTALTRFSNRAP
RISVPDAAACR