Protein Info for IAI46_16885 in Serratia liquefaciens MT49

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 117 to 292 (176 residues), 97.7 bits, see alignment E=3.7e-32

Best Hits

KEGG orthology group: None (inferred from 96% identity to srr:SerAS9_3279)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>IAI46_16885 ABC transporter permease (Serratia liquefaciens MT49)
MSSISFEKSSVPERDLGAVESEGTLPTHRPRRRRVPLTLLLAWAVIAIAVLWALAPQLFT
AYSGTEGIAGAQRLAPGGEHWLGTDQLGRDLYARIVYGASQTLSAALVAVALGLLLGTAL
GLIAGAVGGIADDAVMRLVDVLLSIPGLLLSLSIIILLGFGTVNAAIAVGITSVANFARL
ARAEVVRVRHSDYVEAAYGSGGTFWAVLWRHILPNSLTSVIAFSALQFGSAILAIATLSF
LGYGTPPPTPEWGLLIAEGRNYISTAWWLTTFPGLAVVAVVLAANRISRALGRTPV