Protein Info for IAI46_16870 in Serratia liquefaciens MT49

Annotation: alkylhydroperoxidase domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR04030: alkylhydroperoxidase domain protein, Avi_7169 family" amino acids 182 to 368 (187 residues), 304.2 bits, see alignment E=7.9e-95 TIGR01926: uncharacterized peroxidase-related enzyme" amino acids 220 to 370 (151 residues), 144.7 bits, see alignment E=5.1e-46 PF02627: CMD" amino acids 237 to 297 (61 residues), 44.5 bits, see alignment E=6.4e-16 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 249 to 295 (47 residues), 37.4 bits, see alignment 2.7e-13

Best Hits

KEGG orthology group: None (inferred from 88% identity to spe:Spro_3152)

Predicted SEED Role

"Alkylhydroperoxidase AhpD domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>IAI46_16870 alkylhydroperoxidase domain protein (Serratia liquefaciens MT49)
MTATLLSRDLLAELAEIAPNSALAQARATRQAATDAIQASYLALFSPADAGDFPVVQRLQ
LAQRISEWHADKLLAAHYGTLLQQEGGVQPGPHLQAAFDHAERLAFKPASADAQHLQALQ
QAGWTLDAIVTLSQLIAFVSFQSRLLTGYRLLEGKPLESSGGAPVRAGGWRTESVTLGGR
HAPPVFTRQELGWEPWIAAKPLAEFDEQGQALLTRFGHSDSDYFRLLARNHPVLEQRTLA
DRAIFYTPGGLERKDRELAATVASKVNGCIYCASVHARKAAQLSKQTDEVQRLLDVAPGG
ILSEGQGEPWRTQIDFAAALSATPPQVNAGHLAALREQGLDELALLDLVQSTAFFAWANR
LMLTLGEPFDDL