Protein Info for IAI46_16825 in Serratia liquefaciens MT49

Annotation: N-acetyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 2 to 138 (137 residues), 42.9 bits, E=2.4e-14
• PF13420: Acetyltransf_4
  • amino acids 3 to 156 (154 residues), 61.3 bits, E=3.4e-20
• PF00583: Acetyltransf_1
  • amino acids 16 to 137 (122 residues), 57.9 bits, E=3.7e-19
• PF13508: Acetyltransf_7
  • amino acids 53 to 138 (86 residues), 28.8 bits, E=3.9e-10
• PF13673: Acetyltransf_10
  • amino acids 54 to 145 (92 residues), 25.2 bits, E=4.4e-09

Best Hits

Swiss-Prot: 66% identical to MDDA_PSEAE: L-methionine sulfoximine/L-methionine sulfone acetyltransferase (pitA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 86% identity to srr:SerAS9_3266)

MetaCyc: 60% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (17/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Protein Sequence (172 amino acids)

>IAI46_16825 N-acetyltransferase family protein (Serratia liquefaciens MT49)
MLIRNATITDSAGIAAIYNDAVLNTTAIWNELSVDEANRAAWITERQGMGYPVLVAIDAA
GEVMGYASFGDWRAWDGYRHTVEHSVYVRRDSRGGGVGKTLLIALIEQARAIGKHVMVAG
IESGNHASVQLHINLGFEMVGRMSEVGAKFGKWLDLTFLQLKLDDANAPPKR