Protein Info for IAI46_16800 in Serratia liquefaciens MT49

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 728 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07715: Plug" amino acids 52 to 166 (115 residues), 97.1 bits, see alignment E=8.6e-32 TIGR01783: TonB-dependent siderophore receptor" amino acids 53 to 728 (676 residues), 270 bits, see alignment E=2.5e-84 PF00593: TonB_dep_Rec" amino acids 260 to 698 (439 residues), 180.1 bits, see alignment E=1.4e-56

Best Hits

Swiss-Prot: 54% identical to PFEA_PSEAE: Ferric enterobactin receptor (pfeA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 79% identity to eae:EAE_21490)

Predicted SEED Role

"Outer Membrane Siderophore Receptor IroN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (728 amino acids)

>IAI46_16800 TonB-dependent siderophore receptor (Serratia liquefaciens MT49)
MIYTHSFKLKPGAILLAGLISGSGYAADDLAAESEEMVVLAPAEEQLKQQPGVSIITAED
IAKDPPVNDLSDIIRKMPGVNLTGNSASGSRGNNRQIDIRGMGPENTLILIDGVATTSRN
SVRYSWRGERDTRGDTNWVPAEMVERIEVLRGPAAARYGSGAAGGVINIITKRPTNDWHG
SLSLFTNQPENDKEGATKRTNFSLSGPLAGDALTMRLYGNFNKTDADAADINTAQNGSYA
AGSEGVRNKDVNALFSWKMTPTQILDFELGYSRQGNIYAGDTQYSNGNLSPNDLVSSLYG
QETNRLYRQTYGITHNGIWDWGQSRVGVYYEKTNNTRLQEGSTGRVEGMINSDQFNTSRL
KNVRTTGEVTLPLNLWFEQTMTLGAEWNREQLDDPASMQVTDASGVTIGDISGDPSGRSA
KNSAELSALYFEDNIEVLPGTLLIPGMRFDYHSKFGSNWSPSLNASQELGDHFKLKAGIA
RVFKAPNLYQSSEGYLLATRGNGCPDNIATGSCYLMGNADLDPEVSINKEVGLEFTYEGF
NAGITYFRNDYKNKIVSGTDLVGYASNGYNILRWENGGKAVVEGLEGNLVIPVVKDRLNW
RTNATYMITSENKDTGNPLSVIPKYTVNTMLDYQVTDKLSTNLTWTFYGRQKPREYAEIR
NEVGSLATNEVGAYTVAAVGVNYDLTKDLRLNAGISNLFDKQLYRENQGASTYNEPGRAY
YAGMTLSF