Protein Info for IAI46_16750 in Serratia liquefaciens MT49

Annotation: heavy metal sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 161 to 181 (21 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 3 to 453 (451 residues), 404.7 bits, see alignment E=2.9e-125 PF00672: HAMP" amino acids 181 to 229 (49 residues), 24.3 bits, see alignment 4.7e-09 PF00512: HisKA" amino acids 238 to 303 (66 residues), 57.4 bits, see alignment E=1.9e-19 PF02518: HATPase_c" amino acids 347 to 451 (105 residues), 65.7 bits, see alignment E=7.5e-22

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 62% identity to ypn:YPN_1480)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>IAI46_16750 heavy metal sensor histidine kinase (Serratia liquefaciens MT49)
MMKISISSRMALMFALTMALIMLVLALFLRSSLLTSLQNQMHNELHFRHSLVSPFIEAKG
TARDWPMVQQKLNTLSNSEGSQVKYWVISEDPRYRFGGAPPPGTHWSKLADGFATAANPD
GDCPLYMLIATLPPLGARPEVRYVVAIDSAPYMGTLREFTQALVVISLLGIGLAALLGYA
ISRFGMRPVLNLSEQAHRLVPGTTGQRLDSATLPAELRNLAESFNGVLARQEVAWRQLES
FNADVAHELRTPLTNLIGQTQLALARERSVQELEELLQSNLEELERMTSIVNDMLFLSHA
QAGQYATQLSEVSLREESLKTAEYVEPSFMENDLTIEISGEVRAQVDRRLFHRALANLLE
NSARHAVAGSAVSVLLQEQRGFAVVAVANQGETIAPEHLSRLFERFYRVDSSRVRSDMHH
GLGLSIVRAIALMHQGEAFVHSLDGVNTFGFSLALSRPEENLTPPAPKPLPAAPAIAEIK
RESLS