Protein Info for IAI46_16660 in Serratia liquefaciens MT49

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 742 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 59 to 77 (19 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 302 to 329 (28 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details amino acids 459 to 483 (25 residues), see Phobius details amino acids 526 to 546 (21 residues), see Phobius details amino acids 558 to 578 (21 residues), see Phobius details amino acids 584 to 604 (21 residues), see Phobius details amino acids 646 to 670 (25 residues), see Phobius details amino acids 691 to 714 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 239 to 429 (191 residues), 52.9 bits, see alignment E=1.9e-18 amino acids 536 to 711 (176 residues), 42 bits, see alignment E=4.5e-15

Best Hits

KEGG orthology group: None (inferred from 92% identity to srr:SerAS9_3202)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (742 amino acids)

>IAI46_16660 iron ABC transporter permease (Serratia liquefaciens MT49)
MNAQNRRLDGALVLGALALLLLPWYSQEAGFFDFGWLTTLWQDQASAPALWQILTFQRPW
LAIALLMLLVCALARLLKIGRFRSQLLIAASLVGVVFLLFEGHAIGYSGWNWQWSEHLFG
ALSDGQPAFGAGAILLITTFLLLFSFALAERGVLKGDAFVVAAIVLLVALVTTFVLYPVL
SMFVASVQDVDGSFKPDGLIANMQDPAIWSLSCLKGGSCGTAWRTLTLALMTASGSTLLG
LAFALAATRTPLPFKKGLRMLTVLPIITPPFVIGLALMLLFGRAGVVTELLAGVFGIEPG
RWLYGLTGIWIAQVLSFTPIAFLVLIGVVEGVSPSLEEASQTLRANRWRTFRYVSLPLMA
PGLANAFLISFIESMADFGNPMVLGGSHGVLSTEIFFSVVGAQNDPSRAAVLAIILLCFT
LSAFILQRLWLAGKSFATVTGKGDSGTHCGLPRGLRYGVYALVIPWGLFTLVIYGMILIG
GFVQSWGLDSSLTLGHYARAFGFHWNSGQIVWTGVAWNSFWTTLEIALIAAPLTAIVGLL
TAWLIVRQKFAGRQTFEFMLMLSFAIPGTVIGVSYIMAYNLPPLEITGTALILVACFVFR
NMPVGVRGGIAAMSQLDRSLDEASLTLRASSFRTLRKVILPLLKPAISAALVYAFVRAIT
SISAVIFLVSAQYNMATSYIVGLVENGEYGVAIAYSSVLIVVMLAVILTFQLLVGERRLR
RAIRITTPPVTPPPALHQENAV