Protein Info for IAI46_16655 in Serratia liquefaciens MT49

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13531: SBP_bac_11" amino acids 39 to 284 (246 residues), 63.3 bits, see alignment E=6e-21 PF01547: SBP_bac_1" amino acids 40 to 281 (242 residues), 76.2 bits, see alignment E=9.4e-25 PF13416: SBP_bac_8" amino acids 41 to 299 (259 residues), 70.1 bits, see alignment E=5.4e-23 PF13343: SBP_bac_6" amino acids 89 to 317 (229 residues), 111.6 bits, see alignment E=9.2e-36

Best Hits

Swiss-Prot: 46% identical to Y131_HAEIN: Uncharacterized protein HI_0131 (HI_0131) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 97% identity to spe:Spro_3115)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>IAI46_16655 ABC transporter substrate-binding protein (Serratia liquefaciens MT49)
MQRVTLMAVLAASTALSALPAQAAGKLNMICSADVVVCEQMTNLFEKQHPDIKVSMVRLS
AGEAYARIRTEARNPRTDIWWAGTGDPHMQAADEGLTQPYQSPLLDQQHDWARKQAESAG
YRTVGVYAGALGWGYNTKLLAEKKLKVPACWSDLLDPAYKGEIQMANPNSSGTAYNTLAT
LVQIMGEEPAFDYLKKLNANISQYTKSGSAPVKAAARGETTVGIVFMHDAVAMQVDGFPI
KAVAPCEGTGFEIGSMSIVKGARNLKEAKVWYDWALSADAQSHMKDAKSFQLPSNRNAAI
SEYAPRFENIKLIDYDFKTYGATEKRKALLSRWDKEIGASAQ