Protein Info for IAI46_16515 in Serratia liquefaciens MT49

Annotation: diacylglycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01219: DAGK_prokar
  • amino acids 18 to 118 (101 residues), 103.7 bits, E=2.2e-34

Best Hits

Swiss-Prot: 50% identical to KDGL_PSEAE: Diacylglycerol kinase (dgkA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 79% identity to ebi:EbC_37200)

MetaCyc: 43% identical to diacylglycerol kinase (Escherichia coli K-12 substr. MG1655)
Diacylglycerol kinase. [EC: 2.7.1.107]

Predicted SEED Role

"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)

MetaCyc Pathways

• phosphatidate metabolism, as a signaling molecule (2/5 steps found)
• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism
• Phosphatidylinositol signaling system

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.107

Use Curated BLAST to search for 2.7.1.107

Protein Sequence (120 amino acids)

>IAI46_16515 diacylglycerol kinase (Serratia liquefaciens MT49)
MSFEKKKGINRLISSIKNSLAGLVDAVFTEDAFRQLLVINVILLVVTFTLDITKVERMLL
IASSFILLVVELLNTAIESVVDRISLEIHPLSKRAKDLGGAAQLVAVVMTIMLWLVVLLG