Protein Info for IAI46_16485 in Serratia liquefaciens MT49

Annotation: glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 791 transmembrane" amino acids 10 to 32 (23 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 63 to 79 (17 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details TIGR03074: membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family" amino acids 13 to 788 (776 residues), 1155.7 bits, see alignment E=0 PF13360: PQQ_2" amino acids 193 to 375 (183 residues), 21.9 bits, see alignment E=1.9e-08 amino acids 670 to 771 (102 residues), 23.9 bits, see alignment E=4.7e-09 PF01011: PQQ" amino acids 221 to 255 (35 residues), 32.9 bits, see alignment (E = 5.4e-12) amino acids 287 to 320 (34 residues), 20.7 bits, see alignment (E = 3.9e-08) amino acids 354 to 385 (32 residues), 21.5 bits, see alignment (E = 2.3e-08) amino acids 441 to 466 (26 residues), 25.6 bits, see alignment (E = 1.2e-09) amino acids 663 to 697 (35 residues), 27.4 bits, see alignment (E = 3.1e-10) amino acids 720 to 754 (35 residues), 23 bits, see alignment (E = 7.4e-09)

Best Hits

Swiss-Prot: 74% identical to DHG_ECOLI: Quinoprotein glucose dehydrogenase (gcd) from Escherichia coli (strain K12)

KEGG orthology group: K00117, quinoprotein glucose dehydrogenase [EC: 1.1.5.2] (inferred from 80% identity to ebi:EbC_12100)

MetaCyc: 74% identical to quinoprotein glucose dehydrogenase (Escherichia coli K-12 substr. MG1655)
Quinoprotein glucose dehydrogenase. [EC: 1.1.5.2]

Predicted SEED Role

"Glucose dehydrogenase, PQQ-dependent (EC 1.1.5.2)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway or Respiratory dehydrogenases 1 (EC 1.1.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (791 amino acids)

>IAI46_16485 glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase (Serratia liquefaciens MT49)
MQNKASSSPLIIITALFAALSGLYLLGGGIWLAKLGGSLYYIIAGLVLLITAWLLVRRRA
TALLLYAIFLLGTTIWALWEVGPDFWALTPRLDVTFFFGLWLVLPFIYRKLHARGKLAYS
ALSLALVVTVVALAYAVFNDPQEINGTLEPAQVKVEPQASDADWPAYGRTQEGTRYSPLS
QINDKNVGKLKEAWTFQTGDLKTANDPGEITNEVTPIKIRDTLYLCTPHQKLFALDAATG
KQKWQFDPQLKFNPTFQHITCRGVSYHETPAATGAAADASPALCARRIILPVNDGRLFAL
DADSGKPCADFANNGELNLQSNMPYATPGHYEPTSPPVITDKVIVIAGAVTDNYSNREPS
GVIRGFDVNSGKLLWAFDPGAKDPNAIPADEHHFTPNSPNSWAPSAYDAKLDIVYLPMGV
TTPDIWGGDRTPEMERYASGLLALNATTGKLVWFYQTVHHDLWDMDVPAQPTLADITDKN
GNKVPVIYVPTKTGNIFVLNRTNGELVVPAPEKPVPQGPAKGDRLSPTQPFSELTFRPEK
KLTGADMWGATIYDQLVCRVMFHSLRYEGTFTPPSEQGTLVFPGNLGMFEWGGLSVDTDR
QVAIANPIALPFVSKLIPRGPGNPIEPDENDKGGSGTESGVQPQYGVPFGVTLNPFLSPF
GLPCKQPAWGYISAVDLKTNDIVWKKRIGTVRDSSPLPLPFKMGMPMLGGPVSTAGNVFF
IGATADNYLRAFSVTNGEKLWEARLPAGGQATPMTYEVNGKQYVVISAGGHGSFGTKLGD
YIVAYALPDEK