Protein Info for IAI46_16425 in Serratia liquefaciens MT49

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 365 to 389 (25 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details amino acids 431 to 450 (20 residues), see Phobius details PF00324: AA_permease" amino acids 26 to 450 (425 residues), 313.5 bits, see alignment E=2.4e-97 PF13520: AA_permease_2" amino acids 26 to 440 (415 residues), 133.2 bits, see alignment E=1.3e-42

Best Hits

Swiss-Prot: 38% identical to YTNA_BACSU: Uncharacterized amino acid permease YtnA (ytnA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to spe:Spro_3087)

MetaCyc: 40% identical to threonine/serine:H+ symporter ThrP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71; TRANS-RXN-72

Predicted SEED Role

"Phenylalanine-specific permease" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>IAI46_16425 amino acid permease (Serratia liquefaciens MT49)
MRQIKGFDEIARRQGGLQKQLTAGQMSMLAIGGAIGTGLFLGSAYAIQMAGPSVLLSYFI
GGIVALLLMGCLAEMTSEHPTPGSFGDYAEFYISPLFGFLVRYSYWSCVVLAVGTEVTAI
GMYMQFWFPTTPIWPWVLLFSAAVILINVIGVKSFGQVEYALSTIKVVAIAAFIAIGIGI
LMFSANPAFGLQNFTANGGFFPFGVKGMWFAVIVSIFSYLSIEMIAVAAGEAKNPVIAVK
TAFKGTILRLFIFYMLSIALMLAIVPWRQSGTGESPFLVAMNVIHLPAAAGIFNFIVLVA
ALSAMNSQLYITTRMMFSLSRAGQAPAALGRVSKRGIPVSALAMSCIGIVVSIVLSLVYP
QKSFAAMMSISVYGACFTWLMIFVTHLFFRRQHRQTHLKFRMWGFPYTTLAGAGLMAALL
ISTAFTEFFRMTLWFGIPFTLLLVAIYFFYSRHQPVPAVMETPSVE