Protein Info for IAI46_16420 in Serratia liquefaciens MT49

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details PF00892: EamA" amino acids 26 to 149 (124 residues), 56.7 bits, see alignment E=1.5e-19 amino acids 167 to 298 (132 residues), 50.4 bits, see alignment E=1.3e-17

Best Hits

Swiss-Prot: 63% identical to YDEK_BACSU: Uncharacterized transporter YdeK (ydeK) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 86% identity to spe:Spro_3086)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>IAI46_16420 DMT family transporter (Serratia liquefaciens MT49)
MSSGTEKRRLIGCSNSMPVARHSAQGWINGFLGMLIFSGSLPATRVAVQEFDPMFLTAMR
AVLAALLALSALTLMRQRWPQRRDLAPLVLTALGVVIGFPLLTALALQHTTSAHALVYIG
LLPLATACFGVLRGGERPKAAFWLFSVLGSLLVGAFALSQGATGSWLGDLLMVAAVLLCG
LGYAEGAVLTRKLGGWQVISWALVVALPLTAAAAVVTAPPAWPQVSVGAWCSLGYISLFS
MWIGFIFWYRGLAQGGIAAVGQLQLLQPFFGLALAGLVLHESIQPSMIAVMVGVLVCVYG
AKRFSR