Protein Info for IAI46_16410 in Serratia liquefaciens MT49

Annotation: phenylacetic acid degradation protein PaaY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR02287: phenylacetic acid degradation protein PaaY" amino acids 3 to 194 (192 residues), 335.6 bits, see alignment E=4e-105 PF00132: Hexapep" amino acids 88 to 122 (35 residues), 36.3 bits, see alignment 1.5e-13

Best Hits

Swiss-Prot: 73% identical to PAAY_ECOLI: Phenylacetic acid degradation protein PaaY (paaY) from Escherichia coli (strain K12)

KEGG orthology group: K02617, phenylacetic acid degradation protein (inferred from 96% identity to spe:Spro_3084)

MetaCyc: 73% identical to 2-hydroxycyclohepta-1,4,6-triene-1-carboxyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein PaaY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>IAI46_16410 phenylacetic acid degradation protein PaaY (Serratia liquefaciens MT49)
MPVYQIDGLTPVIDPSSYVHPTAVLIGDVIVGKRVYIGPNASLRGDFGRLVISDGANIQD
NCVMHGFPQQDTVVEQDGHIGHGAILHGCRIRRNAMVGMNAVIMDGAEIGENTIVGAMAF
VKAAAVIEANKLVVGSPARVLRDLTEQELAWKVAGTREYHDLVERCKSSLQEVAPLTAIE
PGRQRLSFGDHLIPKSQL